PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo10G0009900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 217aa    MW: 24874.2 Da    PI: 10.187
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo10G0009900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding635.9e-203783148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEd +l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
  Spipo10G0009900 37 KGRWTPEEDAILFRAVQRHKGRNWKKIAECFK-DRTDVQCLHRWQKVL 83
                     79*****************************9.************986 PP

2Myb_DNA-binding63.83.3e-2089135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+++++ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  Spipo10G0009900  89 KGPWSKEEDDIIIQMVNKHGPKKWSTIAQALP-GRIGKQCRERWHNHL 135
                      79******************************.*************97 PP

3Myb_DNA-binding513.2e-16141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
  Spipo10G0009900 141 KEAWTQEEELALIHAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 183
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9633283IPR017930Myb domain
SuperFamilySSF466896.24E-203598IPR009057Homeodomain-like
SMARTSM007172.3E-163685IPR001005SANT/Myb domain
PfamPF002491.8E-173783IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-243899IPR009057Homeodomain-like
CDDcd001672.00E-133983No hitNo description
PROSITE profilePS5129431.66684139IPR017930Myb domain
SuperFamilySSF466891.5E-3286182IPR009057Homeodomain-like
SMARTSM007172.2E-1888137IPR001005SANT/Myb domain
CDDcd001675.27E-1591135No hitNo description
PfamPF139217.5E-1992150No hitNo description
Gene3DG3DSA:1.10.10.602.5E-27100143IPR009057Homeodomain-like
SMARTSM007172.8E-14140188IPR001005SANT/Myb domain
PROSITE profilePS5129419.075140190IPR017930Myb domain
CDDcd001671.66E-10143183No hitNo description
Gene3DG3DSA:1.10.10.601.4E-21144190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
GGGEEATTAL HEENSSHFQE QRPMHGRISG PTRRSTKGRW TPEEDAILFR AVQRHKGRNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDDII IQMVNKHGPK KWSTIAQALP  120
GRIGKQCRER WHNHLNPAIS KEAWTQEEEL ALIHAHQIYG NKWAELTKFL PGRTDNAIKN  180
HWNSSVKKKL DSYLASGLLS QFQGLPHVES SNLTVK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-68371906159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-68371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008795072.11e-125PREDICTED: myb-related protein 3R-1-like isoform X2
RefseqXP_008795071.11e-125PREDICTED: myb-related protein 3R-1-like isoform X1
SwissprotQ9S7G71e-109MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLK9LVY31e-126K9LVY3_9ASPA; 3R MYB (Fragment)
TrEMBLM0S9I01e-123M0S9I0_MUSAM; Uncharacterized protein
TrEMBLF6HH161e-122F6HH16_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g03750.t011e-121(Vitis vinifera)
STRINGGSMUA_Achr2P19890_0011e-123(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-110Homeodomain-like protein